PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Gh_D11G2561
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Malvales; Malvaceae; Malvoideae; Gossypium
Family bZIP
Protein Properties Length: 409aa    MW: 44783.3 Da    PI: 5.3916
Description bZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Gh_D11G2561genomeNAU-NBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1bZIP_146.67.4e-15211266358
                  XXCHHHCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH CS
       bZIP_1   3 elkrerrkqkNReAArrsRqRKkaeieeLeekvkeLeaeNkaLkkeleelkkevak 58 
                  + kr rr+ +NRe+ArrsR+RK+a + eLe  v +L  eN  L k l  +++ + +
  Gh_D11G2561 211 DAKRVRRMLSNRESARRSRRRKQAHLTELESQVSQLRVENANLLKSLTDISQRYNE 266
                  689*****************************************999988887765 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM003381.4E-16209273IPR004827Basic-leucine zipper domain
PROSITE profilePS5021711.404211266IPR004827Basic-leucine zipper domain
PfamPF001709.8E-13212264IPR004827Basic-leucine zipper domain
Gene3DG3DSA:1.20.5.1701.9E-11213265No hitNo description
SuperFamilySSF579592.01E-11213262No hitNo description
PROSITE patternPS000360216231IPR004827Basic-leucine zipper domain
PfamPF124981.1E-32280403IPR020983Basic leucine-zipper, C-terminal
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0071215Biological Processcellular response to abscisic acid stimulus
GO:0071333Biological Processcellular response to glucose stimulus
GO:0005634Cellular Componentnucleus
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0042802Molecular Functionidentical protein binding
GO:0043565Molecular Functionsequence-specific DNA binding
GO:0046982Molecular Functionprotein heterodimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 409 aa     Download sequence    Send to blast
MHKTTKKPAN DPTNHTMDRV FSVEEVPDHF WSSSAADGGD DDKNICPSSE MNRSASEWAF  60
QQFLREEVDK KGEDNEEEEA KENGCFENNK HDNSPADVED YQAFLKKKLN LACAAVAMSM  120
ASFAKPQDSA ARADSGSQTS NTPQLGSKTV SRGAGDKDDN AVAEVPSFPS GQKKLRAQVR  180
PSTSTGSSKE QSDEDEVEGE NETMENMDPA DAKRVRRMLS NRESARRSRR RKQAHLTELE  240
SQVSQLRVEN ANLLKSLTDI SQRYNEAAVN NRILKADVET LKAKVKMAVE AIKRTTGLNP  300
VFHALPEIPS MSSFDGCPSD TSTDAAVYEE DGPKHTLYQA AANDSISTHD LRINNALADI  360
SSVENIQPVS EGSAVTGNKI GRTASLQRVA SLEHLQKRIR GGVSLNGKQ
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1225232RRSRRRKQ
2227232SRRRKQ
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Ghi.38050.0boll| ovule
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00040PBMTransfer from AT5G28770Download
Motif logo
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_012492794.10.0PREDICTED: light-inducible protein CPRF2-like isoform X2
SwissprotQ990901e-121CPRF2_PETCR; Light-inducible protein CPRF2
TrEMBLA0A0D2PFQ00.0A0A0D2PFQ0_G
STRINGVIT_14s0030g02200.t011e-140(Vitis vinifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM68462743
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G28770.23e-78bZIP family protein